SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WKP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WKP0
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.79e-17
Family Chaperone J-domain 0.001
Further Details:      
 
Domain Number 2 Region: 130-197
Classification Level Classification E-value
Superfamily TPR-like 0.000000963
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WKP0
Sequence length 211
Comment (tr|K9WKP0|K9WKP0_9CYAN) DnaJ-class molecular chaperone with C-terminal Zn finger domain {ECO:0000313|EMBL:AFZ20980.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_5333 OC=Microcoleaceae; Microcoleus.
Sequence
MDLANCYRLLGLTYGASLAEVKASYRRLARRYHPDVNAGDRLTQEKFIQLTEAYKLLLSV
INEPVGSAAVSSASQTVAAKSAPQEAGGMPRSPAAAKATRKPPVVHYTPPLSDMDKQLKW
NAYEQLQQLLKCRRFARAIALVEGLAQRIPFDPEVRQWQAIAYISWGRHLIQEGQLDKAR
IYLKKALKTDPHNRSLWAEIEKDFQRIEEML
Download sequence
Identical sequences K9WKP0
WP_015185113.1.75295 gi|428313409|ref|YP_007124386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]