SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WL14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WL14
Domain Number 1 Region: 337-504
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-44
Family Histidine kinase 0.00086
Further Details:      
 
Domain Number 2 Region: 15-140
Classification Level Classification E-value
Superfamily CheY-like 1.99e-33
Family CheY-related 0.0016
Further Details:      
 
Domain Number 3 Region: 151-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.71e-18
Family Heme-binding PAS domain 0.023
Further Details:      
 
Domain Number 4 Region: 264-348
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.47e-16
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WL14
Sequence length 514
Comment (tr|K9WL14|K9WL14_9CYAN) PAS/PAC sensor hybrid histidine kinase {ECO:0000313|EMBL:AFZ20506.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4838 OC=Microcoleaceae; Microcoleus.
Sequence
MILIDKTPPKIDSFKMVKILVVEDERIIALNLTENLESLGYAVVGIAASGEKAVEKATQL
CPDLVLMDIQLKGNIDGIQAAEQIWESLSIPVIFVTGHSDQSTLERATIIAPFGYILKPV
KEKELSVAISIALQRYEREQLLSAILRGMGDAVIVVDKEHRVKSLNKVAESLTGWQVSEA
RERLLTEVLNLVDEQTQQPVDNPVTAALQQDAILYLRENTLLMSKNGTTIPIGDSAAPIK
DNKGALAGAVLVFRDISDRKRAELAIRQQLEKEQKLNQLQTQFIHTVSHEYRTPLSVILA
CSHLLENNVERLDTEKQLRNCQKIQNSVKYMVELLENVWLYKQAESGQLKLNPARLNLQK
FCSQLVEEYQLMHSDRQEIQFILRGKRTTACVDKKLLQQILGNLLSNALKYSPDKGTVSI
TMTCKNNRVIFQVCDQGIGIPLEDQPHIFEPFHRAANVDVIRGTGMGLAIVKKAVDIHGG
EISFESEVDVGTTFSVILPMVQAEPSSVTLPEFK
Download sequence
Identical sequences K9WL14
gi|428312935|ref|YP_007123912.1| WP_015184641.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]