SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WMX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WMX7
Domain Number 1 Region: 753-937
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.51e-53
Family Adenylyl and guanylyl cyclase catalytic domain 0.00025
Further Details:      
 
Domain Number 2 Region: 578-707
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-26
Family Heme-binding PAS domain 0.074
Further Details:      
 
Domain Number 3 Region: 450-579
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000089
Family Heme-binding PAS domain 0.087
Further Details:      
 
Weak hits

Sequence:  K9WMX7
Domain Number - Region: 950-995
Classification Level Classification E-value
Superfamily TPR-like 0.00109
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WMX7
Sequence length 1003
Comment (tr|K9WMX7|K9WMX7_9CYAN) PAS domain S-box {ECO:0000313|EMBL:AFZ21765.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_6173 OC=Microcoleaceae; Microcoleus.
Sequence
MWLKLRQRIWKWRGVLITAPTVAGVIIAASSTGLFQLLEWVTHDQLVRLRPKEAIDPRIV
IVTIDESDLNKIGVGQLPDTVLARLIEKLKAQKPIAIGLDLYRNLPVEPGHQALVKVFKS
TPNLIGVGKLVGETVPPPPTLSQLGQIAIADLVLDADGKVRRGLLTVTEQGKTQESLGTK
LALMYLESKGVKLQVVDAKKRHYQLGQAIFKPFTGNEASYIRANSGGYQILLNYRGTQDN
FRTISMTDILEDRIPQDWVRDSSAGAFAGKVVLIGAAGQSSNDFFLTPYSSRFFTFLPSS
KRSPKRMPGVVIHANLTSQILSAALDGRPLIKSWTEPIEWLWILGWSFTGATVRWLLLQR
SRFKNNAYHRWIILGIAILSPTGLLLTVTYVSFFGGWWIPVISPFLALVGSTIAIAGYHR
VELQREKTDLELILETTTEHYDTLTTELQNQAEEAARESERRLAQFLEGVSVGVAVIDAN
GNPYFANQKAQELLGKGVVANTSIEQLAEVYQYFIAGTNQVYPVEKLPIVRALKGERTTA
DDIEIHRGDKSIPIEAWGTPIYDESGNVAYAVVAFQDITERKRAEEARRQAEEKYRSIFE
NALEGIFQMTPDGRYLSANPALAQLFGYDSPEELISTLTEIEHQLYVEPHRCSEFIILMQ
QKGAVSGFEFQAYRKDGSMIWVRQNARTVHHANGLLLYYQGFVEDITERKRSEAERVKFT
NQLYQLNQANERFVPRQFLQLLNKESIIDVQLGDQVQLHMSVLFADIRNFTTLSEKMTPE
ENFRFINSYLSQMEPAIIENNGFIDKYIGDAIMALFSGSADDAVRAGIDMLHRLTEYNTT
RTSPERLPIQIGIGINTGSLMLGTVGGPNRMDSTVISDAVNLASRMEGLTKEYGVSMLIS
HHTFTHLHHPVMYAFRVIDRVQVKGKSERVSVFEIFEADPPKLRESKLLTKATFEKGLFL
YTRHALREATQLFEACLELAPEDKVAQIYLKRCQHRAIASLAD
Download sequence
Identical sequences K9WMX7
gi|428314194|ref|YP_007125171.1| WP_015185894.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]