SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WNJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WNJ8
Domain Number 1 Region: 25-269,303-353,387-417
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.53e-41
Family Filamentous hemagglutinin FhaB, secretion domain 0.0077
Further Details:      
 
Domain Number 2 Region: 508-679
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000267
Family iota-carrageenase 0.06
Further Details:      
 
Domain Number 3 Region: 415-534
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000439
Family P22 tailspike protein 0.087
Further Details:      
 
Weak hits

Sequence:  K9WNJ8
Domain Number - Region: 619-738
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WNJ8
Sequence length 970
Comment (tr|K9WNJ8|K9WNJ8_9CYAN) Filamentous hemagglutinin family N-terminal domain protein {ECO:0000313|EMBL:AFZ21763.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_6171 OC=Microcoleaceae; Microcoleus.
Sequence
MNVPVTRTHFGAIVFITSFLFASTLSVQAQIVPDLTLPNNSVVTPNGGTLTITGGTQAGT
NLFHSFEQFSVLTGQTAYFNHALNVQNIVTRVTGGQISSIDGLIQGNGSANLFLINPSGI
SFGSNAQLNLGGSLLASTANSIKFADGSEFSATNPQSPPLLTINVPIGLQFGSNPGSIIN
QSKAVAPGNLQPLPPQIPVSNNVGLAVNPGQTLALIGGDVLLNGGNLTANTGQILLGSVK
SSGFVGFISTPFGLSLNYDNIQNFGNIQLSDGALINTTGLGGGKVDIRGGNVSLNGSRIY
ALTLGNIDGRGIDINAQTFRAEGGTQISTLTRGNGAAGAVNIRATDSVELNGIGVDPYRL
FVGKYLLSGSANPFDPQVVLITGTTSMGNAGNIVIDTEKLLIDNGAVLASTTFSTGNAGN
MTIRARNFDLVGSAVNSGTFAGSTGTGGDITFAGERLTVSDGAALISISRDRGASGDINI
KASESVEVLRTPDGSPVATLIGSTAGGINGQAGDINIDTKRLRISEGAGISLSSGSVIGN
QPLNTTGGPGGNLTLRATESVTIEGISGVLANGSRGPSFISADANAANRGGNMNISTPVL
TLRNGGVITTASLGRGDAGSITINAGRVEVIGNGGQGEFNSQIQTSVGIASRVINPNATA
NGGSLNLNVGQLILRNGGTLNLQALGTGQAGNINVVADAIALDNQSSIDGRTASGLGANI
NLQASEILLRRGSRISTDAGNSNGGNITINTNTLVAVPKEDSDITANAKAGSGGRIRITA
QGIFGTQFRDKLTPESDITATSDLGPEFNGTVQIDIRGIDPNRGLAELPETLTDSSNEIA
ETCSAQSRNNSFVVTGRGGLPPAPSEALNSTPGWIDWRVSTPRDSASSLKLRVPTLGTQE
TRETGSTEDFSREQSAIQNPKSKIQNPLVEATGWVKNADGTVGLVANPSAEVSSNSYYSQ
KCQVNRYSSQ
Download sequence
Identical sequences K9WNJ8
gi|428314192|ref|YP_007125169.1| WP_015185892.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]