SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WPL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WPL4
Domain Number 1 Region: 599-907
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 8.72e-67
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 391-559
Classification Level Classification E-value
Superfamily GAF domain-like 1.96e-55
Family GAF domain 0.0005
Further Details:      
 
Domain Number 3 Region: 237-379
Classification Level Classification E-value
Superfamily GAF domain-like 7.2e-42
Family GAF domain 0.00073
Further Details:      
 
Weak hits

Sequence:  K9WPL4
Domain Number - Region: 166-208
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00288
Family HAMP domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WPL4
Sequence length 909
Comment (tr|K9WPL4|K9WPL4_9CYAN) Methyl-accepting chemotaxis protein {ECO:0000313|EMBL:AFZ22103.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_6525 OC=Microcoleaceae; Microcoleus.
Sequence
MVKQFNTASSGDNSIPDSISQNSSLHNSSFHPVLDAEPVRTGVTKSMMDRTSLQNESTLK
AYVPPQPLNSSSAASWWGRMSFKTKATALAIALGVLPVMTIGGTSLVITQSAINQELKEA
DASGQTVKAQQAKALNNQLALILLLGMGVTGALAGFLATLFAEQTTRKLRHATHALDQLS
KGEVNTRLLVEGSDELALLGSNINGIANFVETIVLEQKANRTKLQNYADTLSASTRGDSQ
FLFDQAVNQAKEELGVERVVIYGFEPDLSGCIVAEAVDQGWPRALADRISDPCIPGKLLD
EYKRGRVVPTSDTRATNYSPAHLQLLNRLQVKANLVVPIVAAGNLLGLLVAHQCSSTRVW
QDTEVHYLQQLATQVGLSLTGVSLAQSRKAEAERAQQLNEIISRVRESIKVEEIYHSAIT
GIREALKTDRVMVYLFDENWQGTIVAESVGSGWPKALGANIADPCFAEQYVEKYKRGRVK
ATENIYDAGLTKCYLGQLEPFKVKANLVAPILAEGKLLGLLVTHQCSSTRPWQEADITFF
KQVAIQVGFALDQAALLEQREQARIVAEMVSVEQRQEKEALQLQLLELLSDVEGAARGDL
TVRADVTTGEIGTVADFFNAVIESLREIVTNVKTAATQVNTSLGENEGAIRQLSEEALKQ
ALDTTRTLDSVQEMSRSIQQVAENARQAAVVARTASTTAETGGLAMDRSVQNILGLRETV
AQTAKKVKRLGESSQQISKVVSLINQIALQTNLLAINAGIEAARAGEEGQGFAVVAEEVG
ELAARSAAATRDIEQIVENIQKETTEVVEAMELGTTQVVEGTHLVEDAKQSLNKILDVSR
QIDTLVQSISTATVSQAETSQAVTELMKEIALVSERTSDSTRKVSGSLKETVGIAQELQA
SVGTFKVGD
Download sequence
Identical sequences K9WPL4
gi|428314763|ref|YP_007150947.1| gi|428314763|ref|YP_007150947.1|NC_019760 WP_015211497.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]