SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WPP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WPP9
Domain Number 1 Region: 348-594
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.41e-94
Family ABC transporter ATPase domain-like 0.000000537
Further Details:      
 
Domain Number 2 Region: 7-332
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.57e-39
Family ABC transporter transmembrane region 0.00058
Further Details:      
 
Weak hits

Sequence:  K9WPP9
Domain Number - Region: 603-661
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000844
Family Homodimeric domain of signal transducing histidine kinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WPP9
Sequence length 677
Comment (tr|K9WPP9|K9WPP9_9CYAN) ABC-type multidrug transport system, ATPase and permease component {ECO:0000313|EMBL:AFZ21781.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_6189 OC=Microcoleaceae; Microcoleus.
Sequence
MSPNQLLLKYALRYPGWIVLTIILGSSSALFNGVSTTLIVPLVLGFLGKEDINLNVGPPA
IQKILAFFDRGDDSSSILFMVAIVVSGIILKNIAVYMNAIVSANLSRKLVRDIREEGIKL
LLEVDMAYFSKTKVGDILNQIGNEVGRATVSIRIAINIFTTSINILIYIGILVSISWKLT
LAASGLLFLVALINQALIQRAKSFGQVLSEKSSKYATILVEMLTGMRLIKTVGNEEYEYK
QLDKFVDDLEKVDARSQANYDAIGPINEIVGTLSILAIVFLGKAFFWQQMESLLTVLLIY
LYVLFRLLPVVSQLNAQRSQFANAAPGTQIVANFLRRDNKPFMTNGSSFYTKIKQGIRWE
GVSFTYPGHEDLVLKGVDLWIPQGTTLALVGASGAGKSTMADLLPRFYDPIEGRITIDGK
DLREYDIRSLRQAMGIVSQDTFLFNNSVRYNIAYGLKNVTDEQVLLAAKRANAYEFIIQL
PQGFDTEIGDRGVLLSGGQRQRLAIARALLRNPDILILDEATSALDTVSERLVQQAIDEL
CRDRTTIVIAHRLSTVQKASQIAVLDKGRVVELGTHEELLKKGGYYTRLYLMQFDRSANE
VIHASANEAFIRASYEIRNRLNPMIGFLQLVVDDLVESSGERDELTEEAYKSAIRLLNNL
ELLEENSSLGEGYWVEG
Download sequence
Identical sequences K9WPP9
gi|428314210|ref|YP_007125187.1| WP_015185910.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]