SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WQ94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WQ94
Domain Number 1 Region: 92-281
Classification Level Classification E-value
Superfamily TPR-like 2.66e-20
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WQ94
Sequence length 344
Comment (tr|K9WQ94|K9WQ94_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ21717.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_6123 OC=Microcoleaceae; Microcoleus.
Sequence
MVHVLSTGKSLSGLKSFNNVIRVRGSVVSQKRSPWVNLVLVLAILAFVGFSMIPLLDIVL
SDNSPSSEATTASTPILPAQKQAELEAQARGYELVVQREPQNPSALRGLLETRLKLGDIQ
GAIPPLEQMAKLNPDQTEYSVLLAQAKQQLGDKEGAAQTYRSILASKPGNLDALEGLVGL
YVQQKRPEAAIGLLQDTLKTATPINDMKPGTVDVISVQLLLGLVYANEKRYTEAIAIYDE
AIKTNKQDFRPPLAKALILKEQGKVAEAKPLFTTAASLAPPKYKDQVAQLAKEATEPKSA
SPGQESPNGKQSPASPPSASPNNQPASPGNAPAAPKATADSPGT
Download sequence
Identical sequences K9WQ94
gi|428314146|ref|YP_007125123.1| WP_015185846.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]