SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9XA96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XA96
Domain Number 1 Region: 115-213
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.79e-40
Family Ribosomal protein S3 C-terminal domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.02e-30
Family Prokaryotic type KH domain (KH-domain type II) 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9XA96
Sequence length 249
Comment (tr|K9XA96|K9XA96_9CHRO) 30S ribosomal protein S3 {ECO:0000256|HAMAP-Rule:MF_01309} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_0982 OC=Chroococcaceae; Gloeocapsa.
Sequence
MGQKIHPVGFRLGVTQEHQSRWFAEPARYPEILKEDHKLRNYVEQKLGRLAQNNAGISEV
RIERKADQIDLEVRTARPGVVVGRGGTGIESLRTGLQELLGGNRQIRINVVEVQQVDADA
YLIAEYIAQQLERRVSFRRVVRQTIQRAQKAGIQGIRIQVSGRLNGAEIARTEWTREGRV
PLHTLRADIDYAYTTAQTIYGILGIKVWIFKGEIIPGQEPVQTPSSNQPRRRQPQQRRRQ
QFEDRSNEE
Download sequence
Identical sequences K9XA96
WP_015187436.1.9315 gi|434391773|ref|YP_007126720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]