SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XB71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XB71
Domain Number 1 Region: 19-263
Classification Level Classification E-value
Superfamily PP2C-like 1.83e-16
Family PP2C-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9XB71
Sequence length 266
Comment (tr|K9XB71|K9XB71_9CHRO) Uncharacterized protein {ECO:0000313|EMBL:AFZ28882.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_0273 OC=Chroococcaceae; Gloeocapsa.
Sequence
MNVNDFFKQNKTIEEVHWRVAAASVRGRGHEKVGQLCQDAHYWQKLPSGILVAAVADGAG
SANLGKVGAIVAAQTAVETVCDRLTTSPLPADDNEWRSVLNNALAAARTTVEAEAVACQL
SARELATTLIIVVATPNLVVAAQIGDGVAVASDRQGNLIALTAPQFGEYINETTFLVSPQ
ALDTAQLTLWQGKTAKIALLSDGLQMLALELNQGKPYVPFFSPLFHFVAQIKDETEAKEQ
LVAFLRSPKITERTDDDLTLLLATLS
Download sequence
Identical sequences K9XB71
WP_015186759.1.9315 gi|434391095|ref|YP_007126042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]