SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XBN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XBN2
Domain Number 1 Region: 173-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.16e-116
Family Leucine aminopeptidase, C-terminal domain 0.000000509
Further Details:      
 
Domain Number 2 Region: 1-176
Classification Level Classification E-value
Superfamily Macro domain-like 5.89e-38
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9XBN2
Sequence length 491
Comment (tr|K9XBN2|K9XBN2_9CHRO) Leucyl aminopeptidase {ECO:0000256|HAMAP-Rule:MF_00181} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_0915 OC=Chroococcaceae; Gloeocapsa.
Sequence
MEIRAIDTPLLDWTGDCLAIGLFEEAEELQGDVAQLNDKFAGALKEIIEETEFKGKEGSS
AVTRIGGASPVRKVFLIGLGNQETLRLDSLRRAGATVARLAKKEKCKTVGVNLPTVDNDP
AATVQAIAEGLQLASYQDNRFKSEPEEKVLVERVDLLGFAGQEAAIARANSICSGVNLAR
ELVAAPPNEVTPITLAETAQKIAEDHGLQVEILEREECEKLGMGAFLGVAQASDLPPKFI
HLTYKPEGTPKRRLAIIGKGLTFDSGGLNIKAGAGSSIEMMKMDMGGAGATLGAAKAIAQ
LKPDVEVHFISAATENMISGRAMHPGDILKASNGKTIEVNNTDAEGRLTLADALVFAEKL
GVDAIVDLATLTGACIIALGDEIAGLFSPDDELAQQLAQAAEAAGEKLWRMPFEEKYFEG
LKSGIADFKNTGPRGGGSITAALFLKQFVKETPWAHLDIAGPVWTDKENGCSNPGATGYG
VRTLVHWVLSN
Download sequence
Identical sequences K9XBN2
gi|434391707|ref|YP_007126654.1| WP_015187371.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]