SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XBU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XBU0
Domain Number 1 Region: 124-412
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.89e-49
Family Pectate transeliminase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9XBU0
Sequence length 611
Comment (tr|K9XBU0|K9XBU0_9CHRO) Parallel beta-helix repeat protein {ECO:0000313|EMBL:AFZ30120.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_1559 OC=Chroococcaceae; Gloeocapsa.
Sequence
MTNHDSNNRKSNIFRVISTKGRAPHLPLGAGLSALFLVATGAILGNSAIASSKKLAQFVV
PTTNDPAPTPTLTPSPSPSPSPTPTSLPSPIPSPSPTPTSLPSPSPTLSPTQTTPTTPST
NQVPATTTVIYVNPQTGTDSAGAGSTAAAPFRTITYALSQAQPGTAIQLAPGTYSSETGE
VFPLTIKQGVTLRGDEASKGQSIVITGGGQYISPTFARQNVTVRAENNSAVSGVTITNPN
TRGTALWIESANPTVTNNTFIDSNRDGVFVTGTANPKIEGNVFSKNGGNGISVARSAQGE
IRNNTFQDTGFGLAIGGASSPLVAENQIKENEDGIYISESARPVLRGNVIENNKRDGVVA
TINAQPDLGTAESAGNNIIRSNERYDVYNATRGNALLAVGNTIDAKRTSGKVNLVAPQFA
FSDVQGLWAQPYIAALASREIIAGFPDGTFKPNEPVTRAQFAAIVSKAFTPTPQREAQDF
NDVSRNFWGYQAIQSAYRGGFVAGYPGGAFQPQQQIPRVQVLVSLANGLNLRADNPNVLS
TYADASQIPGYATDAVAAATQRQLVVNYPTPNQLNPNRPATRAEVAAFVYQALVNSGRAQ
AIASPYLVRVP
Download sequence
Identical sequences K9XBU0
WP_015187995.1.9315 gi|434392333|ref|YP_007127280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]