SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XDR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XDR3
Domain Number 1 Region: 35-192
Classification Level Classification E-value
Superfamily IpsF-like 8.5e-66
Family IpsF-like 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9XDR3
Sequence length 193
Comment (tr|K9XDR3|K9XDR3_9CHRO) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase {ECO:0000256|HAMAP-Rule:MF_00107, ECO:0000256|RuleBase:RU004395, ECO:0000256|SAAS:SAAS00731908} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_1235 OC=Chroococcaceae; Gloeocapsa.
Sequence
MRSLKVMGNRQLSITNYQLPTAVSLTKRGFFVTVMNIRIGNGYDIHQLSFDRRLILGGVE
IPHDRGLLGHSDADVLTHAIMDAMLGALSLGDIGLYFPPTDPQWKGADSLVLLAKVNSLI
RDRGWQIGNIDSVVVAERPKLKPHIQQMRSRLAEVLEVQPEQIGIKATTNEKLGPVGREE
GIAAYAVALLQRG
Download sequence
Identical sequences K9XDR3
gi|434392020|ref|YP_007126967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]