SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XFK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XFK1
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.02e-66
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000644
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.25e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9XFK1
Sequence length 327
Comment (tr|K9XFK1|K9XFK1_9CHRO) Pyruvate dehydrogenase (Acetyl-transferring) {ECO:0000313|EMBL:AFZ30841.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_2329 OC=Chroococcaceae; Gloeocapsa.
Sequence
MAETLFFNALRAAIDEEMARDATVFVLGEDVGHYGGSYKVTKDLYKKYGELRLLDTPIAE
NSFTGLAVGAAMTGLRPIVEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPMVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTPYNAKGLLKSAIRDENPVLFFEHVLLYNLK
EDLPETEYLLPLDKAEVVRQGKDVTILTYSRMRHHVMQAVKTLEKNGFDPEVIDLISLKP
LDFETIGESIRKTHRVIIVEECMRTGGIGAELIASINDRLFDELDAPVLRLSSQDIPTPY
NGALERLTIVQPEQIIEAVEKMVALRV
Download sequence
Identical sequences K9XFK1
gi|434393054|ref|YP_007128001.1| WP_015188713.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]