SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XKA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XKA4
Domain Number 1 Region: 8-303
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.72e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9XKA4
Sequence length 309
Comment (tr|K9XKA4|K9XKA4_9CHRO) FAD-dependent pyridine nucleotide-disulfide oxidoreductase {ECO:0000313|EMBL:AFZ32509.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_4059 OC=Chroococcaceae; Gloeocapsa.
Sequence
MNAQSPANHFDVIIVGAGPAGLSAALVLGRSRRRVFIIDAGKPRNAVSHTAHSFFSRDGI
APLELLQIGREQLHLYDGVKFQMGEVIDARNLGNQFQVTLNNDAQFTSRKLLLATGVKDI
LPAIEGFAELWGNSIFHCPYCHGWEVRDQPLAIYGKGEAAFEMALMLTGWSRDLILCSDG
SAELSDAQRQRLVSWGIELREEKIARLEHKNGLLTEIVLANGEAIPRRGIFLRPQLQQHS
DLAAKLGCELTENKLVEVAEDQQTSVAGVYAVGDTSTLFSQITVAVTSGATAAAFINRTL
IEENLMHAR
Download sequence
Identical sequences K9XKA4
WP_015190377.1.9315 gi|434394722|ref|YP_007129669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]