SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9Y6E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Y6E1
Domain Number 1 Region: 5-162
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.75e-35
Family HD domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9Y6E1
Sequence length 189
Comment (tr|K9Y6E1|K9Y6E1_HALP7) Metal dependent phosphohydrolase {ECO:0000313|EMBL:AFZ42481.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_0244 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MKLSPRFSQALTFANDLHLKQKRKGSHSPYISHLLTVCSLVLEYGGDEDCAIAALLHDAI
EDQGGAATRETIRLQFGERVTTLVDGCTESDQTPKPPWQKRKEAYIAHIPKMSDQVALIS
AADKIHNARSILRDYQTLGEEIWERFRGGKEGTLWYYRSLVSAFRKRNVTPIVEELTTVV
DQLEAIAYG
Download sequence
Identical sequences K9Y6E1
gi|428774908|ref|YP_007166695.1| WP_015224359.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]