SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YBP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YBP5
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.75e-73
Family Histidine biosynthesis enzymes 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YBP5
Sequence length 257
Comment (tr|K9YBP5|K9YBP5_HALP7) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase {ECO:0000256|HAMAP-Rule:MF_01014} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_2107 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MDIIPAIDLLEGKCVRLYQGDYNQVEVFSDRAVEMAKQWEEQGATRLHLVDLDGAKAGKP
MNQSTIAEIVETVSVPVQVGGGLRDRASIAELLSLGVSNAIVGTIAVEQPELVQALCQEF
PQQITIGIDARNGKVATRGWLETSEIRAKDLAQQMANQGAAAIIYTDIHRDGTLTGPNLE
ALRDLAENVSIPVIASGGMSSITDLLSLLSLEPIGVTGAILGRALYANKIDLREAVQAVG
NGRLQDVPPNGDFPTFA
Download sequence
Identical sequences K9YBP5
gi|428776696|ref|YP_007168483.1| WP_015226144.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]