SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YC52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YC52
Domain Number 1 Region: 62-310
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.51e-27
Family iota-carrageenase 0.082
Further Details:      
 
Weak hits

Sequence:  K9YC52
Domain Number - Region: 374-448
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000461
Family Galacturonase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YC52
Sequence length 627
Comment (tr|K9YC52|K9YC52_HALP7) Uncharacterized protein {ECO:0000313|EMBL:AFZ44047.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_1879 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MTNKLIYRSLGLVLISLLSGCASETLYSSPFNSEDDQLLETSQLLDHSPTLPQEKQFPND
IGWINIKQDYGAKGDGKTDDTQAIQKALATPYSSYNRPKLIYFPKGTYLVSDTLQFPAEG
MQCCVTFQGQGRDNTIIKLKDNLPAYRADAAAAVIRTRAGNIAFRNYIRDLTVNTGRGNP
GAVGIDYISNNRGAIKDVTIKSEDGQGRIGLSMLRQWPGPSLIKNVSIEGFDVGIRTFHS
VYGMVFENINLSNQNEVGLQNTSNTIAIRNLKSNNSVPVIHNVGNGLTILLNGEFQGGSS
SVSAINNRAYIYARNVTAQGYQSAIQNWDHIVPDLYHREYIFDRVDSLFDAPKHSLQLPI
EETPVFHDNNLNHWANVKDYPSVQAAMNSGHSTIYFPRGDYPTSGFINIPDTVKKIIGFE
SRLGAPKNEKVVFQITDKSTDPLIIEGFILNERVTIQHASPRTLALKYSQLQGSLLNSKE
AGKLFLEDVQTELHLDYPQQVWARQLNIETLSNPRTKISNNGGNLWILGLKTEGKGSVIE
TTNGGQTELLGTVIYPVRKFTDAEQKTQAAFVNENSNHSLIYSLSAASAQRNYQIQVKEI
RNGETKVFLTEDLPSYQIPLFVGYNNN
Download sequence
Identical sequences K9YC52
gi|428776474|ref|YP_007168261.1| WP_015225922.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]