SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YCT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YCT9
Domain Number 1 Region: 349-541
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.13e-50
Family Ppx associated domain 0.00081
Further Details:      
 
Domain Number 2 Region: 152-335
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.13e-41
Family Ppx/GppA phosphatase 0.00088
Further Details:      
 
Domain Number 3 Region: 26-148
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.06e-35
Family Ppx/GppA phosphatase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YCT9
Sequence length 546
Comment (tr|K9YCT9|K9YCT9_HALP7) Ppx/GppA phosphatase {ECO:0000313|EMBL:AFZ44200.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_2036 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MVNTIYPIQTQSLNAQNSNLKKERVIAAIDIGTNSIHMVIVEIEPSLPAFNIIAREKDTA
RLGDRDPETGRLTVEAMERAMSALERGQELARSFQAEEVVAVATSAVREAPNGREFIKNV
REHLGLTINLISGQEEARRIYLGVLSAMEFNEKPHVIMDIGGGSTELILGDGHEPRCLSS
TKVGAVRLASEFISTDPVSNKELKFLQAYIQGRMERPVEELKAKLAPEELIKFVGTSGTI
ECLATIHANEKFNTTPNPLQGYSFSRKDLEDVVKLLASLNLKERANLPGMSGRRAEIIVP
GAMILLETMKMLDVKDITICERALREGLIVDWMLTHGLIENRLRYQSSVRDRSVIKIAQK
YKVDLESSQRVADFSLDIFDQIQGKLHQWGSQERELLWVAAILHNCGFYISHSAHHKHSY
YLIRYAELLGFTENEIEIIANIARYHRKSKPKKKHTNFQNLPDKTTKKMVSEVSAILRLA
VALDRRQIGAITAVHCNYKEEKQELELELFPKDVNDDCALELWNLDDKKVIFENEYGVKV
IPKLSP
Download sequence
Identical sequences K9YCT9
gi|428776627|ref|YP_007168414.1| WP_015226075.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]