SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YEX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YEX4
Domain Number 1 Region: 447-620
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.22e-59
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YEX4
Sequence length 624
Comment (tr|K9YEX4|K9YEX4_HALP7) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:AFZ45511.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_3397 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MVKQASILIGSLVATALTAAPAHAGKLTFWRFNENNNRLLFQTEERVQPRAQLIFNPTRV
VIDLPDTVLGHSLVNQDVGGAIQEVRVGQFNQETTRLVVELAPGYTLDPEKVKIREERPQ
RWSVELPPVQRTANPSRRRSALDRRSPRRETPSPLLEVGQSPPNTKADTNHPNFQVTRSG
LLLRLDSPPGKEIEVERSEDKKQISFHVPKATLPSDLPSVLPVGDYGISHAEFKSNGNDT
AEVTLHVNPESPTWQAFPTLTSKGGLVFLPEGGMGQVRNNLSTPPIPASLTNHPEQSQTT
VVQAVDLIDNQLLVRANQPITGTGNWNRVSGVYEITIPNAELADPVQGPQLTRNSPVSQI
RVRQQDEETVVVQVQSSPGVRILDRLNQPSENTIAIALRQLQQTTPRHLPHLSNSSQQRH
TIHVPQSRPAPSPPSSPLPRGNNQDGLLVVLDPGHGGKDPGAVGIGGLQEKNVVLPISHH
VRKTLERNGLQVKMTRWDDRFISLGGRTEMANRADADLFISIHANAISMSRPDVNGTETF
YYANGRALAQAIQRSILSKINMRDRGVKKANFYVLRNSAMPAVLVEVGFVTGREDAPRLA
DPNFRQRMADAIADGILQYVRQTQ
Download sequence
Identical sequences K9YEX4
WP_015227383.1.10129 gi|428777938|ref|YP_007169725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]