SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YFR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YFR7
Domain Number 1 Region: 419-596
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.16e-44
Family N-acetylmuramoyl-L-alanine amidase-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YFR7
Sequence length 608
Comment (tr|K9YFR7|K9YFR7_HALP7) Cell wall hydrolase/autolysin {ECO:0000313|EMBL:AFZ45342.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_3226 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MKNWLTPLLSGFLLTSYISSPPAFAQSKQDLMLVYPPKQHQTTAEKIFLIGTASATVYVN
GQPIEQSAAGHFAPSFPLQMGDNQFTIRSGDEQVTRRITRISPVPTPPSDGGFAPNSLFP
SQPITRQVGETICLEAVGTPQGEVTATVAEQIIPLLPQAKHALPPNYAVLTGNNAPLSQF
TQLYQGCFKSEIAGNLGNPIYTIKFGDQTITASDTENITILTNAHPQASSYHGGVQMTPI
EKTVVEVTAEAGAARTGPGTSYSRLTPLPKGTRATVTGREGKWLRLGYGAWIDGEATRVI
PDAVSPQTFIRSIKAEPTPQSTEIHFPLQVPVPVRVQQEEDTFTLTLHHTIAQTDTIHLD
DDPLIERLDWQQIDPETVQYTFHLKSDQQWGYNLRYEGPNLILSLKHPPTARSAQPLAGM
RILVDPGHGGEELGAKGPTGYPEKAVNLKVSQLLQAELEQRGATVYMTRETDKFVSLADR
IAMINDLNPAIALSIHYNALPDDGDAINTSGIGAFWYNPPAHDLAVFLHNYLVEELNRDS
YGVFWNTLALTRPHTTLAVLLELGFMINPTEFEWVMNPAAQEKLAGTIADGVEVWWKQKK
ASAETTQR
Download sequence
Identical sequences K9YFR7
gi|428777769|ref|YP_007169556.1| WP_015227214.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]