SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YHJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YHJ5
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.07e-66
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000676
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.54e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YHJ5
Sequence length 327
Comment (tr|K9YHJ5|K9YHJ5_HALP7) Transketolase central region {ECO:0000313|EMBL:AFZ45860.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_3756 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MAQTIFFNALREATNEEMARDDTVFVLGEDVGHYGGSYKVTKDLYKKYGELRLLDTPIAE
NSFTGMAVGAAMTGLRPIVEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPLVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTAYNAKGLLKSAIRDDNPVLFFEHVLLYNLK
EDLPEGEYWLPLDKAEMVRQGKDVTILTYSRMRHHALQAVKPLEEKGFDPEIIDLISLKP
LDMEAVAESVRKTHRVIIVEECMRTGGIGAELTARINDELFDELDAPVVRLSSQDIPTPY
NGTLERYTIVQPQDIIAAVEDMVALKV
Download sequence
Identical sequences K9YHJ5
WP_015227731.1.10129 gi|428778287|ref|YP_007170074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]