SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YHV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YHV5
Domain Number 1 Region: 32-211
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000105
Family Lipase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YHV5
Sequence length 254
Comment (tr|K9YHV5|K9YHV5_HALP7) Uncharacterized protein {ECO:0000313|EMBL:AFZ45668.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_3558 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MTNWEEVAGNSVLLPPQPKGLIHFLGGAFVATVPQVTYSWLLESLAEEGYGVIATPFLND
LNHSAIAQRALNRFETAYQRLGLFQRYLPIYGIGHSMGCKLHLLINSLYEVKRAGNLLIS
YNNYPAREAVPFVEQLNHLAAFDLEFTPSPERTFDIVQNNYQKTRTLLVRFQNDTIDQTE
DLKPILEQRFPSLVSYLQLSGNHLTPVNPKEWNWNPGTNFSPIDALGQWVKQQFYRDITQ
LKKEVIRWLDPIDI
Download sequence
Identical sequences K9YHV5
WP_015227540.1.10129 gi|428778095|ref|YP_007169882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]