SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0AR04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0AR04
Domain Number 1 Region: 25-165
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.09e-71
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000158
Further Details:      
 
Domain Number 2 Region: 1-24
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0000102
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L0AR04
Sequence length 165
Comment (tr|L0AR04|L0AR04_9EURY) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AFZ76938.1} OX=183760 OS=uncultured Methanomicrobiales archaeon. GN=mcrA OC=environmental samples.
Sequence
AAVADLAFAAKHAGVIQMGDILPARRARGPNEPGGIKFGHFADMIQADRKYPNDPARATL
EVVGAGAMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDDYTYYGMDYIKSKYKVNWQSP
SEKDKVKATQDVVNDIATEVNLYGMEQYEQYPTALEDHFGGSQRA
Download sequence
Identical sequences L0AR04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]