SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0CUZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0CUZ4
Domain Number 1 Region: 378-459
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L0CUZ4
Sequence length 464
Comment (tr|L0CUZ4|L0CUZ4_MOUSE) V-myc myelocytomatosis viral oncogene-like protein {ECO:0000313|EMBL:AGA20435.1} OX=10090 OS=Mus musculus (Mouse). GN=MYC OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
Download sequence
Identical sequences L0CUZ4 P04198
HR6419 ENSP00000281043 ENSP00000281043 gi|19923312|ref|NP_005369.2| NP_001280157.1.87134 NP_001280157.1.92137 NP_005369.2.87134 NP_005369.2.92137 XP_016859657.1.92137 9606.ENSP00000281043 ENSP00000281043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]