SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0JMB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0JMB6
Domain Number 1 Region: 5-31
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000506
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0JMB6
Sequence length 42
Comment (tr|L0JMB6|L0JMB6_NATP1) Uncharacterized protein {ECO:0000313|EMBL:AGB31978.1} KW=Complete proteome; Reference proteome OX=797303 OS=NCIMB 786 / 157). GN=C488_06148 OC=Natrinema.
Sequence
MEHPYGRCQHCGERLYAHIEGDYQCVNCDRRYTEADLETRAV
Download sequence
Identical sequences L0JMB6 M0BDX6
gi|433591386|ref|YP_007280882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]