SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0RFR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0RFR0
Domain Number 1 Region: 34-107
Classification Level Classification E-value
Superfamily Fe-only hydrogenase smaller subunit 6.93e-17
Family Fe-only hydrogenase smaller subunit 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L0RFR0
Sequence length 112
Comment (tr|L0RFR0|L0RFR0_9DELT) Iron hydrogenase small subunit {ECO:0000313|EMBL:CCO25035.1} KW=Complete proteome OX=1121451 OS=Desulfovibrio hydrothermalis AM13 = DSM 14728. GN=DESAM_22768 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MNISRRSFIKAAGIMTGYAVLSMNIAKEAVADVMGFVARRQESVYAADANPEVYKYRKSQ
NNPMITKIYDPENGFLHDGPCGHESHELLHTHYIDRSEKLKALKEKGIELNI
Download sequence
Identical sequences L0RFR0
WP_015337633.1.21188 WP_015337633.1.81540 gi|436842756|ref|YP_007327134.1| gi|551596640|ref|YP_008685933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]