SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L2FPS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L2FPS1
Domain Number 1 Region: 191-401
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.47e-42
Family Glutathione peroxidase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 58-152
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.54e-20
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000051
Family PHBH-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L2FPS1
Sequence length 404
Comment (tr|L2FPS1|L2FPS1_COLGN) Phenol 2-monooxygenase {ECO:0000313|EMBL:ELA28180.1} KW=Complete proteome; Reference proteome OX=1213859 OS=(Glomerella cingulata). GN=CGGC5_11168 OC=Colletotrichum.
Sequence
MVIPREDNMVRLYIQIASSTDPDFDPRKTATEEEVQESAKRILQPYSIEWERTEWYSVYP
IGQGISDRYTLDHRVFLGGDACHTHSPKAGQGMNTAFLDAQNLAWKIHAVEAGFAHRDIL
KTYETERRDVAETLLNFDNKYAALFSKRPPAASEVEAASDKAITDGSDNEFIQTFKESCE
FTSGYGVAYKPNSLNWSESHPAKSPLIHREGTKLRTGRLFMNADVTRVVDANVVHLEQEV
PLNGSFRIFIFAGKPSVTKAALKDFASHMNNKRSFYAAYVRDDVDSVSHHEKHNPHSLFF
TICTIFAASRSSIEISRDVPDVIGRYREHVYADDRWDRRHLDAKAAAHAKMGLDEERGGV
VVVRPDGYVGMVAKLVEGSGTVDALNEYFSTFCTKKLGETLAQL
Download sequence
Identical sequences L2FPS1
XP_007282785.1.4750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]