SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5K3S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5K3S5
Domain Number 1 Region: 486-855
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-127
Family Hect, E3 ligase catalytic domain 0.00000000331
Further Details:      
 
Domain Number 2 Region: 2-118
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.98e-24
Family Synaptotagmin-like (S variant) 0.009
Further Details:      
 
Domain Number 3 Region: 431-471
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000167
Family WW domain 0.00011
Further Details:      
 
Domain Number 4 Region: 144-187
Classification Level Classification E-value
Superfamily WW domain 0.000000000000153
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 304-344
Classification Level Classification E-value
Superfamily WW domain 0.000000000000223
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 382-416
Classification Level Classification E-value
Superfamily WW domain 0.00000000000223
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L5K3S5
Sequence length 862
Comment (tr|L5K3S5|L5K3S5_PTEAL) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:ELK05391.1} KW=Complete proteome; Reference proteome OX=9402 OS=Pteropus alecto (Black flying fox). GN=PAL_GLEAN10023443 OC=Pteropodidae; Pteropodinae; Pteropus.
Sequence
NSDPYVRVTLYDPMNGILTSVQTKTIKKTLNPKWNEEILFKVHPQQHRLLFEVFDENRLT
RDDFLGQVDVPLYPLPVKNPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSE
EDNAEQTEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQ
WKRPTPQDSLTDAENGNIQLQAQRAFTTRRQISEETESVDNRESSENWEIIREDEGTVYS
NQAFPSPPPSNSLDVHPRLAEELNALLTVCGNSATGQPVSSSNHSGRRGSLQAYTFEEQP
ALPVLLPTSSGLPPGWEEKQDERGRPYYVDHNSRTTTWTKPTIQATLETSQQPSSQSSTS
PQPQVPTSDSAQQVTQPSEMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
LLRGKTLLDSSNDLGPLPPGWEERTHTDGRVFYINHNIKRTQWEDPRLQNVAITGPAVPY
SRDYKRKYEFFRRKLKKQNDIPSKLEMKLRRANVLEDSYRRIMGVKRADFLKARLWIEFD
GEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFCFI
GRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDL
RFVIDEELFGQTHQHELKIGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFE
LIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSINHPVIQWFWKAVLMMDSE
KRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYES
FEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences L5K3S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]