SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5K6S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5K6S9
Domain Number 1 Region: 585-631
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000706
Family TSP-1 type 1 repeat 0.00081
Further Details:      
 
Domain Number 2 Region: 164-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000759
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 104-151
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 540-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000681
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L5K6S9
Sequence length 631
Comment (tr|L5K6S9|L5K6S9_PTEAL) Complement component C8 beta chain {ECO:0000313|EMBL:ELK06198.1} KW=Complete proteome; Reference proteome OX=9402 OS=Pteropus alecto (Black flying fox). GN=PAL_GLEAN10023800 OC=Pteropodidae; Pteropodinae; Pteropus.
Sequence
MEGLGIKPSPSASLVQVHDPCNFSKLCPPTSRLLLSRQKPPIHAYNISTNKMASHHVHSA
PYSLQTGFINARGERPPSLESNAINESLAKSRQTRSVAVTLMPIDCELSSWSSWTMCDPC
QKKRYRHATLLQPSQFRGDPCIFSDKEVEDCETKAPCRSQVRCEGFVCAQTGRCVNRRLL
CNGDNDCGDQSDEGNCKKIYKKCQQEMDRYWAIDRLASGINLFTNSLEGPVLDHRYYGGG
CSPHYILNTKFRKPYNVESYTPQTQSKYEFALTEYESYSDFEYNVTKAERSKFSFSFGFK
IPGIFEVGINTASDNGKRFVSRTKRFSHTRSKFLHARSDLEVAHYKLKPRSLMLHYEFLQ
RVKQLPLEYGYGEYRDLFRDFGTHYITEAVLGGIYEYTLIINQEAMEKGDYSLKDIHSCA
QNGFKIGAAVKAVYVKLGVSLETCEGILKEIKDRKKRNTMVEDLVVLVRGGASEYITALA
YKDLPTADLMQEWGDAVQYNPDIIKIKAEPLYELVTAADFAYSSRVKQNMKQALEEFQKE
VSSCHCAPCQGNGVPVLKESRCECICPNGFQGQACEITLRENVPIDGKWNCWSNWSSCSG
GQKTRQRQCNNPLPRNGGSACLGPASETLSC
Download sequence
Identical sequences L5K6S9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]