SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5KD60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5KD60
Domain Number 1 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 542-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 7 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-20
Family KRAB domain (Kruppel-associated box) 0.00062
Further Details:      
 
Domain Number 8 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 10 Region: 337-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000455
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 136-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000145
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 86-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000159
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  L5KD60
Domain Number - Region: 641-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000577
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L5KD60
Sequence length 662
Comment (tr|L5KD60|L5KD60_PTEAL) Zinc finger protein 709 {ECO:0000313|EMBL:ELK09629.1} KW=Complete proteome; Reference proteome OX=9402 OS=Pteropus alecto (Black flying fox). GN=PAL_GLEAN10000252 OC=Pteropodidae; Pteropodinae; Pteropus.
Sequence
DSVAFEDVAVNFTPEEWALLDPSQKKLYRDVMRETFENLASVGKGMEDYDTEDQYKNQGR
KLRSHIEERICESEASSECEENLSLISNLSLNKRIFPRVKPWEHSVCREVFIQHSSSNRH
IRCHTGHDPNEYQKHGEKPRKCKASMRAFSYLQIFEKYERNHNGREKPNECKQCTKVFSR
RSHLRRHERIHTGEKPYECKQCTKAFSCLSSLRRHERTHTGEKPYECKQCGKFYRDHSYL
QTHKRIHTEEKPYECKQCSKTFRYLSNLRSHERIHTGGKPYECKLCGRAFRESYFLKTHE
KTHTGEKPYECKQCTKTFSCLSRLQTHKRTHTGEKLYKCKECGKAYRDYCKLQTHERTHN
EEKPYECKQCGKFYRDHSNLQKHKRIHNEEKPYKCKQCTKAFSCLRYLQRHERIHTGGKP
YECKQCGKAFRESRCLKTHERTHTGEKPYKCKQCSKAFICPSSLRKHKRVHTVLKPYACK
ECGKAFRESHSLKTHERTHTGEKPYKCKQCTKTFSFLSSLSKHKRVHTEQKLSKCKECGK
SYVDYCKLQIHERTHTGEKPYKCNQCSKAFSCVSYLQTHERIHTRGKPYECKQCGKAFRE
SRFLKTHERTHTGEKPYKCNQCSKAFSYVSYLQTHERIHTRKPYECKQCTKAFRYHSSLC
KI
Download sequence
Identical sequences L5KD60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]