SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5LG29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5LG29
Domain Number 1 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-20
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-19
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 9 Region: 105-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 14-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-17
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 11 Region: 590-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-17
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 58-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-17
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L5LG29
Sequence length 648
Comment (tr|L5LG29|L5LG29_MYODS) Zinc finger protein 850 {ECO:0000313|EMBL:ELK25152.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10002068 OC=Vespertilionidae; Myotis.
Sequence
MTFWFVIGSTWRMSFWDRVTFDDVAVYFSREEWGLLDEAQRRLYQEVMLENLALVSSLVH
SGERRYECMQCGKSFRRKFYLILHWRVHTGERPHECRECGKSFTRSVLTLHRRLHTGERP
FRCSECKRTFSGSSILILHQRAHTGKRPYECSECWKSFSQQSYLSQHQAIHSGRQSYECS
ECGKAFISHRGLSYHLRVHSGKRPYQCSDCDKSFTSQAGLRYHLRVHTGRRPYQCRECGK
SFLYGSYLSIHQRVHTGERPYQCSECGKSFLRRHHFLTHQRIHTGERPYQCSECGKSFTS
GNNLSNHQRVHTKERPYQCSECGKSFLRRHHFLAHQRIHTKERPHQCSECGKSFILRQHL
LVHQRVHAGQRPYQCSECGKSYCSKFNLIQHQRVHTGERPYECSECGKRFTSSSVFNYHK
KVHSGERPYQCNDCGKSFFSSSNLNTHQRAHTGERPYECSDCGKSFFRRSHLRTHQRVHT
GERHQCDECGKSFASAFNLRNHQRDHTGEKPYACTVCGISFTTQRKLRYHRGVHTGEGPY
ECRECGKSFTSHYALHDHERLHTDKKPYECTKCGKSFRANSHLIEHWRVHTGEKPHQCGE
CGKSFSSGSGLRYHQSVHTRLRPHECSECGKSFMQRHHLLAHRRVHTK
Download sequence
Identical sequences L5LG29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]