SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L5LZB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5LZB2
Domain Number 1 Region: 41-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 249-363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 452-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 162-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 208-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 413-450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  L5LZB2
Domain Number - Region: 363-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00184
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L5LZB2
Sequence length 767
Comment (tr|L5LZB2|L5LZB2_MYODS) Low-density lipoprotein receptor-related protein 3 {ECO:0000313|EMBL:ELK31365.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10022575 OC=Vespertilionidae; Myotis.
Sequence
MDVPADVPGLDQLLVGLMALVFTLDSSGEASTSPPLLTAACSGKLEQHTERRGVIYSPAW
PLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGS
AIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGP
WQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDCGD
GSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDTRRVLLQLELRL
GYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATY
QVKGYCLPWEQPCGSSIEGDMGDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYP
CEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQD
GSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEA
EFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRR
RLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAALDPPAPLTDTGSAGA
AGDGSPSAPVHTPEVGPSVLPPLSLQDPEYRPVDKDRKACRDPLMDSPASVDMPREPCSA
QDPHSLAPTAGSTLGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences L5LZB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]