SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5M6G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5M6G8
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000417
Further Details:      
 
Domain Number 2 Region: 220-304,331-351
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 8.24e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 423-485
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L5M6G8
Sequence length 497
Comment (tr|L5M6G8|L5M6G8_MYODS) Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:ELK33917.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10006216 OC=Vespertilionidae; Myotis.
Sequence
PSTLLQDHENQRVFDMLGRKCWTLATAVIQLYMAMPPGAERWTKKHCGAVCFVKDNPQKS
YFIRLYSLQTGLLLWEQELYSQLVYSTPTSFFHTFAGDDCQVGLNFADQSEAQAFQALVQ
EKIQKRNQRQSGDRRPLPTPPAPVNEERRGGFPPLPSHPGGDQGGPAAGSLSLGMGTVDI
QNPDITSSRYRGLPVPGPGPVDKKRSGKKKIRKADIGAPSGFKHVSHVGWDPQNGFDVNN
LDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRG
GNQPPRPPTVGSNKGRSGPLPPVPLGGVPPPPPPTPRGPPPPGRGGPPPPPPPATGRSGP
PPPPLPGAGGLSMPPPPPPLPGAGGSPMPPPPPPPPPPPSSGDVPVPPPVPPTLGTVGGL
APVGGRGALLDQIRQGIQLNKTPGASESSALQPPPQSSEGLVGALMHVMQKRSKAIHSSD
EGEDQAGDDDEDDEWDD
Download sequence
Identical sequences L5M6G8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]