SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7II98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7II98
Domain Number 1 Region: 18-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.19e-173
Family Glycosyl hydrolase family 7 catalytic core 0.000000000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7II98
Sequence length 449
Comment (tr|L7II98|L7II98_MAGOY) Glucanase {ECO:0000256|RuleBase:RU361164} KW=Complete proteome OX=1143189 OS=oryzae). GN=OOU_Y34scaffold00180g1 OC=Magnaporthe.
Sequence
MKRALCASLSLLAAAVAQQVGTNEPEVHPKMTWKKCSSGGSCSTVNGEVVIDGNWRWIHN
IGGYENCYSGNKWTSVCSTNADCATKCAMEGAKYQETYGVSTSGDALTLKFVQQNSSGKN
VGSRMYLMNGANKYQMFTLKNNEFAFDVDLSSVECGMNSALYFVPMKEDGGMSTEPNNKA
GAKYGTGYCDAQCARDLKFIGGKGNIEGWQPSSTDSSAGIGAQGACCAEIDIWESNKNAF
AFTPHPCENNEYHVCTEPNCGGTYADDRYGGGCDANGCDYNPYRMGNPDFYGPGKTIDTN
RKFTVISRFENNRNYQILMQDGVAHRIPGPKFDGLEGETGELNEQFCTDQFTVFDERNRF
NEVGGWSKLNAAYEIPMVLVMSIWSDHFANMLWLDSTYPPEKAGQPGSARGPCPADGGDP
NGVVNQYPNAKVIWSNVRFGPIGSTYQVD
Download sequence
Identical sequences G4NIA4 L7II98 L7JBJ3
XP_003720331.1.18062 148305.A4UC71 MGG_10712T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]