SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7JAI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7JAI2
Domain Number 1 Region: 336-403,502-556
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.93e-22
Family Nuclease 0.022
Further Details:      
 
Domain Number 2 Region: 62-247
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.07e-19
Family Nuclease 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7JAI2
Sequence length 568
Comment (tr|L7JAI2|L7JAI2_MAGOP) Uncharacterized protein {ECO:0000313|EMBL:ELQ65241.1} KW=Complete proteome OX=1143193 OS=oryzae). GN=OOW_P131scaffold00514g8 OC=Magnaporthe.
Sequence
MARSLRRNSFVHDFIDRLQKAPKPLDTSRAYASDELPSYNYTDSLELGRLVTTSRVRSFR
VGTGASIYTSTLLPAILKAHHEAIIVTCFWAPSKTLDALRETLEALAAHRRRIVDEGAGS
LPTLRVRICLSSRSLLQKLLHTSSRDGYIYPPSTWEKQLGLLSEEKLRAARIELHVKSLF
FLPFSVMHPKFVVIDRRRAFMPSCNVSWEPWLEGCVEFEGDAVDALMAFYQRTWEPDMDV
TLPLPLMQDEDLDEAIFNPAVEAPVLPMVRSTASYAVSFVAGHQQASPLVVAGGHEATAT
LENTIQTTILPSSHHRNPRFRFLPWQAHAPAPATPLNTAVMQLMDHAQRQIYVQTPNVTA
PCVIDGLLAALQRGVHVRIVTGRNMMMMEQIVTAGTTTSRCISSLIRRYEIMREAAMAPP
GSRHSLLSSWSRPPSRNYGAGTNGEPIQTLSSLPPPVGRLQISYFCSLNPGSKETGKGKG
GRHGRRRPSDLEEVLDDAAEEPVCPHIKLMIVDGRYTLLGSGNMDRASFYTSQELGVLFH
GDAFASPVQGVMDRCLEGRLEKVYDSER
Download sequence
Identical sequences G4MM94 L7I0B0 L7JAI2
MGG_05521T0 XP_003710387.1.18062 148305.A4RPH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]