SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7N228 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7N228
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily DNase I-like 1.96e-40
Family DNase I-like 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7N228
Sequence length 499
Comment (tr|L7N228|L7N228_MOUSE) Predicted gene, 21750 {ECO:0000313|Ensembl:ENSMUSP00000096471} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gm21750 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
KKQESNPSTNQKEDSHKNRMPTLTTEIKGSNNYFSLISLNINGLNSPIKRHRLTDWLHKQ
DPTFCCLQETHLREKDRHYLRVKGWKTIFQAKGLKKQAGVAILISNKIDFQPKVIKKDKE
GHFILIKGKILQKELSILNIYAPNARAATFIKDTLVKLKAHIAPHTIIVGDFNTPLSSKD
RSWKQKLNRDTVKLTEVMKQMDLTDIYRTFYPKTKGYTFFSAPHGTFSKIDHIIGHKTGL
NIYKDIEIVPCILSDHHGLRVIFNNNINNGKPTFTWKLNNTLLNDTLVKEGIKKEIKDFL
EFNENEATTYPNLWDTMKAFLRGKLISLSASKKKRERAHTSSLTTHLKALEKKEANSPKR
SRRQEIIKLRVQINQVETRTIQKINQTRSWFFEKINKIDKPLARLTRGHRDNILINKIRN
EKGDITTDPEEIQNTIRSFYKRLYSTKLENLDEMDKFLDRYQVPKLNQGQVNDLNSPISP
KEIEAVINSLPVKKGPGPD
Download sequence
Identical sequences L7N228
ENSMUSP00000096471 ENSMUSP00000096471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]