SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7N481 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7N481
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 6.8e-18
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7N481
Sequence length 315
Comment (tr|L7N481|L7N481_MOUSE) Predicted gene 6309 {ECO:0000313|Ensembl:ENSMUSP00000134203} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gm6309 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MFSCFQGSRGSGHKKAKRGFLVRFWRHLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYIHQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKRNVPSSDVDRARELLSVL
EDQEAIELQIEQDFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAIL
DPFEPKATIELPLSLHQAVPASDGTLSPVDVTADEATGVAADFAADVSPARQLFVSYTVQ
LGTPDFVFPLPEVDI
Download sequence
Identical sequences L7N481
ENSMUSP00000134203 XP_891827.1.92730 ENSMUSP00000134203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]