SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8ANH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8ANH3
Domain Number 1 Region: 50-313
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.19e-30
Family TK-like PP module 0.0026
Further Details:      
 
Domain Number 2 Region: 381-574
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.12e-28
Family TK-like Pyr module 0.021
Further Details:      
 
Domain Number 3 Region: 579-730
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000141
Family Transketolase C-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8ANH3
Sequence length 731
Comment (tr|L8ANH3|L8ANH3_BACIU) Uncharacterized protein {ECO:0000313|EMBL:BAM53524.1} KW=Complete proteome OX=1204343 OS=Bacillus subtilis BEST7613. GN=BEST7613_4593 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTVASTAPAFCQGIRFFGENLPDFDRYGQETAIASGAKAISSANDPQAVYQTLLAADALR
YLTLQTTASKESGHPGGFASIAEAIAALVMLGYKNTVTEVGHHAPGFYSTMFLDRSLEAM
GINNVQELGDRFREMHGLLGHLSGQIPGLLAPAGPLGQGQHFAMAGAKLYPGVLFPVTIG
DGGLGEPYIMSSFGHFHTAYPQVTNFLPILVWNGFSQEHHSMVSTQSNEAMVNYWQGNGF
KNVILVNAKDFDDSNQAGDFVDSTKFSFQQRLAFTQAVLEATDKAAQAALGGTLTVLIVK
QLKGAGVHKSGAKSHNLYPGDSLDKDYIVSALQERALSPEAWQLVRTNFERSHGGPASQT
VVTESVLPLADLGTLPLKEFALEDKQVATTAMGELVVHVGKQDSNFVVTNADGNAASGIN
NINVGLKIVHPTVDEDYFQQPNGQVYEPLSEDACAGLAAAQALFGGRTLWCSYESFAING
LPIWQTVTQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIENYFAAMMRNGNIFPL
FPCDANGIQVCYDWALTTSNKGIPITASKSPLPIRTTLEQNRQGLAKGGILLHNSTGSKT
IVFAVIGDMTLIPVLEAASQLESEGYGVKVVSVINPRRLYRPHDVQWQDCSEADSGFLSD
AEFTELFGGDALIGVTGGSGAMLEPVLLRSACPRDLFAWKRGETTASAGQLMAYNGLTAQ
ALGDRAKALLP
Download sequence
Identical sequences L8ANH3 Q55517
gi|16332076|ref|NP_442804.1| gi|16332076|ref|NP_442804.1| gi|383492872|ref|YP_005410549.1| gi|383323819|ref|YP_005384673.1| WP_010874098.1.11876 WP_010874098.1.1889 WP_010874098.1.18904 WP_010874098.1.33690 WP_010874098.1.35395 WP_010874098.1.47586 WP_010874098.1.99424 gi|383326988|ref|YP_005387842.1| 1148.sll0529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]