SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8ARG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8ARG8
Domain Number 1 Region: 11-144,214-326
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-17
Family FAD-linked reductases, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8ARG8
Sequence length 498
Comment (tr|L8ARG8|L8ARG8_BACIU) Uncharacterized protein {ECO:0000313|EMBL:BAM54504.1} KW=Complete proteome OX=1204343 OS=Bacillus subtilis BEST7613. GN=BEST7613_5573 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MVQVGAAAINRVDVAVIGGGIAGVAIAEYVARHTNLSVQLLEQNSHLGGDSSGKLEGWFH
TGALYSGQDDGQTFFNCVNGVEDLLNHYSHYFAGRCNLTLEQFDHGYRPTVTGAGWFDPN
PVYLIHPQRHSPEMLQSGLKGDRVQLEMQLKRVLGRLEMAYGQQFNWRSPTGNGAVAPDY
DHLESYEQRSCSLLGQSEKISHYCQQFDLSHGVKPSDYALLKSLDCAMDTQGILQDLTAS
ALAHGTAIATGINLEQINVDRYGPVRVQSIFYRDCQGQQHYLKAKAFIFAVGAGFERILP
TLQVRAKLKQSRSTMVVAYPAISSHNFVRMSTKNSYHFNHFFQRANIPDSSEFLNYSMLA
NSGYVSNENDYLASGEIELLLDTAARYFSEENLYQRQLWSYDCVKTEFISDDAQKRRYSY
WIEVNPQSNYLCVLPGKFSFFPTVAVQTLKQLKTILPTEEVDRSHRDYSAHYHQAQALVA
SPYPHQLLASYWKNNANS
Download sequence
Identical sequences L8ARG8 Q55639
gi|383323098|ref|YP_005383951.1| gi|383326267|ref|YP_005387120.1| WP_010873384.1.11876 WP_010873384.1.1889 WP_010873384.1.18904 WP_010873384.1.33690 WP_010873384.1.35395 WP_010873384.1.47586 WP_010873384.1.99424 SgR64 gi|16331357|ref|NP_442085.1| gi|383492151|ref|YP_005409827.1| gi|16331357|ref|NP_442085.1| 1148.sll0321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]