SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8AT42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8AT42
Domain Number 1 Region: 11-342
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.89e-100
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8AT42
Sequence length 342
Comment (tr|L8AT42|L8AT42_BACIU) Pyruvate dehydrogenase E1 component subunit alpha {ECO:0000256|RuleBase:RU361139} KW=Complete proteome OX=1204343 OS=Bacillus subtilis BEST7613. GN=BEST7613_5746 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MVSERILPELNTAEISLDRETALVLYEDMVLGRFFEDKCAEMYYRGKMFGFVHLYNGQEA
VSSGIIKAMRQDEDYVCSTYRDHVHALSAGVPAREVMAELFGKETGCSRGRGGSMHLFSS
AHNLLGGFAFIGEGIPVALGAAFQTKYRREVLKDDGYDQVTACFFGDGTSNNGQFFECLN
MAALWKLPILFVVENNKWAIGMAHERATSQPEIYKKASVFNMVGVEVDGMDVVAMHKVAT
EAVARARAGEGPTLIEALTYRFRGHSLADPDELRSAEEKQFWAARDPIKKFAAFMTEHEL
ASNEELKAIDKRIQEVIDDALAFAESSPEPNPEDLRKYIFAD
Download sequence
Identical sequences L8AT42 P74490
WP_010873216.1.11876 WP_010873216.1.1889 WP_010873216.1.18904 WP_010873216.1.33690 WP_010873216.1.35395 WP_010873216.1.47586 WP_010873216.1.99424 gi|383491982|ref|YP_005409658.1| gi|16331186|ref|NP_441914.1| gi|383326098|ref|YP_005386951.1| gi|383322929|ref|YP_005383782.1| gi|16331186|ref|NP_441914.1| 1148.slr1934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]