SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8AU23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8AU23
Domain Number 1 Region: 191-325
Classification Level Classification E-value
Superfamily CheY-like 3.27e-37
Family CheY-related 0.0012
Further Details:      
 
Domain Number 2 Region: 14-69
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000163
Family Homodimeric domain of signal transducing histidine kinase 0.0037
Further Details:      
 
Weak hits

Sequence:  L8AU23
Domain Number - Region: 455-600
Classification Level Classification E-value
Superfamily PP2C-like 0.000112
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8AU23
Sequence length 603
Comment (tr|L8AU23|L8AU23_BACIU) Regulatory components of sensory transductionsystem {ECO:0000313|EMBL:BAM55065.1} KW=Complete proteome OX=1204343 OS=Bacillus subtilis BEST7613. GN=BEST7613_6134 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MMNPSINSVDIESATAFIRHELRTPINAIVGYGEMVQEELAEANSPLTEEIDTLLVEAQK
LLEIINLFVKHSDGEDKSDFQKLFSTIPHSTNFSITNIILNCDSLLEAEECTNELELTED
IRKIKLAALRLQGLVNNIESIFTNFLESLNPGNGTGLSPDFIFPSSSNTNEISLGNIKTN
GVDSRELLKGKILVVDDNPSNLDLFFQHLTRKGHAVTTCLSAKDALGLLQSQNYDLILLD
LLMPETNGDQFLEYLKTSVEFQHIPVIIVSALDEFESIIRCIEMGAEDFLPKPFDPVLLK
ARIGSSLEKKRLRDQEKLYTQQVEGLSEMMAKELEKGRQMQKNFLPAHLLTRSGWEFSAY
FSPAQQLAGDFYDLFELPGDRLGIVVADVCDKGVGAALFMGLFRSLIRIFSGQAALDGLI
NPSFNLPSGQGLLDVNLDNLLNNINFEPLESIKLINNYVAINHGEASMFATIFFGILEPS
SGKLSYINGGHEPVFIVDSNHQLKTKLTSTGPAVGMLPDLQFKTAEIILQPGDLLLSYTD
GVTEAKSPTGNFFGKEKLLNALGSSFNSVDQLMLNIKESLEEHMGEAQQFDDITLLAIKF
QTT
Download sequence
Identical sequences L8AU23 P74139
gi|383322559|ref|YP_005383412.1| gi|16330817|ref|NP_441545.1| 1148.slr1983 WP_010872848.1.33690 WP_010872848.1.35395 WP_010872848.1.47586 WP_010872848.1.99424 gi|16330817|ref|NP_441545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]