SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8HXE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8HXE8
Domain Number 1 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 1-28
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000017
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8HXE8
Sequence length 216
Comment (tr|L8HXE8|L8HXE8_9CETA) RPE-spondin {ECO:0000313|EMBL:ELR47984.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_03520 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
TCFCDQACRLTGDCCFDYARACPARPCIVGEWSPWSGCASQCRPTARVRRRAVQQEPQNG
GEPCPALEERAGCLEYATPQGEDCGHAFVPAFITTSAFNKERTRQAASPHWTTSTEDAGY
CMEFKTESLTHHCALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQ
TLHWQAIGNPRCQGTWKKVRRVEQCSCPAVHSFIFI
Download sequence
Identical sequences L8HXE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]