SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8IA43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IA43
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.48e-40
Family Dual specificity phosphatase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8IA43
Sequence length 223
Comment (tr|L8IA43|L8IA43_9CETA) Serine/threonine/tyrosine-interacting protein {ECO:0000313|EMBL:ELR53330.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_04806 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDESLQSGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGSTGSLKRTHEEEDDFGNMQVAAAQNG
Download sequence
Identical sequences G3MYQ0 L8IA43
ENSBTAP00000054687 ENSBTAP00000054687 NP_001180057.1.59421 NP_001180057.1.76553 XP_005900018.1.15283 XP_019823675.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]