SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8IDW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IDW2
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily Nudix 4.06e-24
Family MutT-like 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8IDW2
Sequence length 164
Comment (tr|L8IDW2|L8IDW2_9CETA) Diphosphoinositol polyphosphate phosphohydrolase 3-beta {ECO:0000313|EMBL:ELR54421.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_11323 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
AAVREVFEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVSIGRKREWF
KVEDAIKVLQCHKPVHAEYLQKLKLGGSPTNGNSVAPSPPEGDP
Download sequence
Identical sequences A7MBH2 L8IDW2
NP_001030565.2.59421 NP_001030565.2.76553 NP_001094766.1.59421 NP_001094766.1.76553 XP_005898548.1.15283 XP_005898549.1.15283 XP_014334539.1.15283 XP_014334540.1.15283 XP_019811099.1.53367 XP_019812068.1.53367 ENSBTAP00000049572 ENSBTAP00000049572 9913.ENSBTAP00000049572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]