SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8IMG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IMG7
Domain Number 1 Region: 39-308
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.19e-61
Family Glycerophosphoryl diester phosphodiesterase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8IMG7
Sequence length 318
Comment (tr|L8IMG7|L8IMG7_9CETA) Glycerophosphodiester phosphodiesterase domain-containing protein 3 {ECO:0000313|EMBL:ELR57248.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_15158 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSPLLYYALPALGSYVMLSFFFLRRPRLLHTPWVPAFRPRLGAHRGGSGERLENTMEAME
NSMAQRADFLELDCQLTRDGVVVVSHDKNLSRQTGVNRDVGSLNFEDLPLLKEELEVYFS
PGHFARGADRHMMRLEDLFRRFPRTPMSVEVKERNEELIHKIACLVRHYDRNEITIWASE
KSSIMKKCKAANPEMPTSFTLSRGFWVLLFYYLGLLPFISIPEKFFMCFLPTIINRTYFP
FSHPGLNQLAAVVAKWLIMRKSLIQHLQQRGVQVVFWCLNEESDFEAAFNLGATGVITDY
PTALRCYLDSRGPPALAS
Download sequence
Identical sequences E1BJ80 L8IMG7
NP_001070458.2.59421 NP_001070458.2.76553 XP_005894540.1.15283 XP_019843642.1.53367 ENSBTAP00000042857 ENSBTAP00000042857 9913.ENSBTAP00000042857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]