SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8ITU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8ITU0
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily SNARE-like 2.98e-28
Family Synatpobrevin N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8ITU0
Sequence length 303
Comment (tr|L8ITU0|L8ITU0_9CETA) Vesicle-trafficking protein SEC22c {ECO:0000313|EMBL:ELR59756.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_15439 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSLILFACVVRVRDGLPLSASTDFYHSQDFLECRRRLKTLALRLAQYPGRGSAEGCDFSI
HFSSSRDVACMAICSLQCPAAMAFCFLETLWWEFTASYDTTCVGLASRPYAFLEFDNVIQ
KVKWHFNYVSSTQMDSSLGKIQEELKFQPPVVLTLEDTDVANGVMNGHTLMHLEPAPSFR
MEPVTALGILSLILNIMCAALNLIRGIHLAEHSLQVAHEEIGNILAFLIPFVACIFQCYL
YLFYSPARTMKVVLMLLFICLGNVYLHGLRNLWQILFHIGVAFLSSHQILTRQLQDKQSD
CGV
Download sequence
Identical sequences L8ITU0 Q2YDJ2
NP_001040011.1.59421 NP_001040011.1.76553 XP_005891138.1.15283 XP_010815828.1.76553 XP_010815830.1.76553 XP_010815831.1.76553 XP_010815833.1.76553 XP_010815834.1.76553 XP_010833747.1.44457 XP_010833748.1.44457 XP_010833749.1.44457 XP_019839840.1.53367 XP_019839841.1.53367 XP_019839842.1.53367 XP_019839843.1.53367 XP_019839844.1.53367 ENSBTAP00000008631 ENSBTAP00000008631 9913.ENSBTAP00000008631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]