SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8IV52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IV52
Domain Number 1 Region: 32-309
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-74
Family Eukaryotic proteases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8IV52
Sequence length 366
Comment (tr|L8IV52|L8IV52_9CETA) Serine protease 40 {ECO:0000313|EMBL:ELR59057.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_11780 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QSDRRCRTGRMDITAAEGLGPGWKVACMLAVVLLCLHSLLPHTKVAGTTDGPPVSAVSSC
GKTAVTGKIIGGKNTVDKRWPWQAGLLYQGMFICGASLISDYWVISAAHCFQMSHKPSDY
KILLGYYQLEKPTSYSQLAAVYRLFIHADYNKHYYQESDITLLQLYRPAKFSDSIRTVCL
PEVNIQLLDLILCWITGWGMVNDQELLPTPRTLQEAQVGFLDNSFCESILKPPETINQTI
AIQDGMLCAADFLAGKSVCRGDSGGPLVCKLNDTWYLMGLASFSTPCEKPIGPGIFTKVS
YFNQWITEKQKSSPNPDPSTAPPEEKPPALFSFNSLGNVHKPRNFLVLVASQTFLLLLIF
LWTMGL
Download sequence
Identical sequences L8IV52 Q2T9Y2
ENSBTAP00000012471 9913.ENSBTAP00000012471 ENSBTAP00000012471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]