SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8IVD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IVD8
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-51
Family Calponin-homology domain, CH-domain 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8IVD8
Sequence length 297
Comment (tr|L8IVD8|L8IVD8_9CETA) Calponin {ECO:0000256|RuleBase:RU361224} OX=72004 OS=Bos mutus (wild yak). GN=M91_04893 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHPHNYYNSA
Download sequence
Identical sequences L8IVD8 Q2HJ38
NP_001039844.1.59421 NP_001039844.1.76553 XP_005890825.1.15283 XP_006063945.1.26621 XP_010826612.1.44457 XP_019819776.1.53367 ENSBTAP00000014883 ENSBTAP00000014883 9913.ENSBTAP00000014883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]