SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8IVK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IVK8
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8IVK8
Sequence length 160
Comment (tr|L8IVK8|L8IVK8_9CETA) Galectin {ECO:0000256|RuleBase:RU102079} OX=72004 OS=Bos mutus (wild yak). GN=M91_00387 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
KLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLT
CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEH
PRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences D2HXX2 G7NA66 G7PMB6 G9L0M8 L8IVK8
ENSFCAP00000001122 9615.ENSCAFP00000004729 9685.ENSFCAP00000001122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]