SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8J2S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8J2S1
Domain Number 1 Region: 1125-1301
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.47e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.23e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 456-576
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-25
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 4 Region: 883-1040
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-22
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1436-1568
Classification Level Classification E-value
Superfamily PH domain-like 4.53e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.51e-16
Family SAM (sterile alpha motif) domain 0.0000555
Further Details:      
 
Domain Number 7 Region: 584-686
Classification Level Classification E-value
Superfamily PH domain-like 7.8e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 1017-1117
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000822
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8J2S1
Sequence length 1704
Comment (tr|L8J2S1|L8J2S1_9CETA) Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 {ECO:0000313|EMBL:ELR63031.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_05902 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSSVSEVNVDIRDFLMSINLEQYLLNFREFGFNNVRDCAEINDSVLLKVGISPTGHRRRI
LKQLQIILSKMQDIPIYANIHKTKKNDETSKDHQAPSSAQNTSLEFSDSHGVQIPSRIQL
ETVTKNVGENEVCVENSQSLKSDDKLTLPTHNFPIPEDEPHSNSGSFQDSLLRNEITDIE
SLITEKTVGCTAEEEHTGRDDLISENVGKLPNADLEFLSSHDSSVSEANSGNGTNVLLES
SPPSPFFQFQGEMVVNDLYVPSSPVLTPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGI
SGSYFRERRNVATSTGKSVTQQNTNEENSSSILPYGETFLLQRLENSKKRSIKNEFWTQE
ETLKGETTTERNSFFVKSSIYDNRTENISENKVEDIWIPREDKSNLPIDSASESEYSTVE
ECFQSLRRKNSKPSKSRTQKAANLDPVNRHSYPLSSTSGNADSPVISSNVISPYACFYGS
STRKVKSGWLDKLCPQGKRMFQKRWVKFDGLSISYYNNDKEKYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISLLLNALKLQALSSQSQAAIAPEKCGYLELRGY
KAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSF
TAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWYNESNRSCADCKAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHM
DCSVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVM
CATGDPEHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIYSEGRLNQESSQSTFLCDFL
YQAPAGASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAVHKE
DFCLNTGPIFTFEIYLPSERAFLFGAETSQVQRKWTEAIAKHFVPFVAENLTEADYDLIG
QLYYKDCHALDQWRKGWFAMDKSNLRFCLPMQEGQEDRMHLRRLQELTISTVVQNGEKLD
VLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLGRNDVPIIVNSCIAFV
TQYGLGYKNIYQKNGDPLHVSELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDA
LLTKELYPYWISALDTQDDKERIKKYGAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHM
SAHNLALVFSSCFFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD
TQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKDDIWATFEV
IENEELERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTIDTIKHYNERKALENIKEG
VLKVKEEPSKILSGNKFQDRYCVLRDGYLLLYKDLKSSKPDKMFSLSSVKFYLGVKKKMK
PPTSWGLTAYSEKHHWHLCCESSQTQTEWMANIFIAQHENDIWPPAGKERKRSITKNPKI
GGLPLIPIQHDRNATQARRETESAKAELERLRLGAKRDQGGDGTLKEKASIVAQCLEHKD
EKLRNRTRKHRSFNCLEDTEAEVFPGRQKGHKGLKTLRKTEDRNGKDTLDCNNKLPPKVI
EELSVVLQRSRTLPKELQDEQVVQ
Download sequence
Identical sequences L8J2S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]